General Information

  • ID:  hor005638
  • Uniprot ID:  Q9DGC8
  • Protein name:  Gonadoliberin-1
  • Gene name:  gnrh1
  • Organism:  Oryzias latipes (Japanese rice fish) (Japanese killifish)
  • Family:  GnRH family
  • Source:  animal
  • Expression:  Expressed in the cell bodies of a cluster of neurons in the preoptic region.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Oryzias (genus), Oryziinae (subfamily), Adrianichthyidae (family), Adrianichthyoidei (suborder), Beloniformes (order), Atherinomorphae (superorder), Ovalentaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  QHWSFGLSPG
  • Length:  10
  • Propeptide:  MVVKTWMPWLLVSSVLSQGCCQHWSFGLSPGGKRELKYFPNTLENQIRLLNSNTPCSDLSHLEESSLAKIYRIKGLLGSVTEAKNGYRTYK
  • Signal peptide:  MVVKTWMPWLLVSSVLSQGCC
  • Modification:  T1 Pyrrolidone carboxylic acid;T10 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  Teleost species possess three paralogous GnRHs: mdGnRH and cGnRH-II have been identified in tetrapods; sGnRH has no tetrapod ortholog and is thought to be a duplication of cGnRH-II.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q7T273-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005638_AF2.pdbhor005638_ESM.pdb

Physical Information

Mass: 127592 Formula: C52H70N14O14
Absent amino acids: ACDEIKMNRTVY Common amino acids: GS
pI: 7.55 Basic residues: 1
Polar residues: 4 Hydrophobic residues: 3
Hydrophobicity: -50 Boman Index: -489
Half-Life: 0.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 39
Instability Index: 5006 Extinction Coefficient cystines: 5500
Absorbance 280nm: 611.11

Literature

  • PubMed ID:  11006121
  • Title:  A novel form of gonadotropin-releasing hormone in the medaka, Oryzias latipes.
  • PubMed ID:  12137956
  • Title:   Structural characterization of GnRH loci in the medaka genome